PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g019011m
Common NameCISIN_1g019011mg, LOC102612201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NAC
Protein Properties Length: 348aa    MW: 38846.6 Da    PI: 8.5528
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g019011mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.2e-52141391128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrF Ptdeel+v+yL++kv+g++++l ++i e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +
  orange1.1g019011m  14 LPPGFRFYPTDEELLVQYLCRKVAGQHFSL-QIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKII 104
                        79***************************9.89***************7777799***********************************99 PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  orange1.1g019011m 105 TT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                        99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6610162IPR003441NAC domain
PROSITE profilePS5100560.05314162IPR003441NAC domain
PfamPF023652.3E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGVPETDPLS QLNLPPGFRF YPTDEELLVQ YLCRKVAGQH FSLQIIGEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLF EPSRKNGSSK LDDWVLCRIY KKHSGSQKPV SATSVSSSKE  180
HSNGSCSSSS SHLDDVLESL PEIDDRFFAL PRMNSLKTLQ QEDNKVNNLQ HLGSGNFDWA  240
SLAGLHSVPE FVSAAQTQTT TQSHGVACYA NNDFYVPSMP QMCHVNSGRV GNSVEEEVQS  300
GLRNQRVDNS GLFQHNSAVL TQPNFCSLVD PYGLRHPTQS SGFGFRH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-11111687174NAC domain-containing protein 19
3swm_B1e-11111687174NAC domain-containing protein 19
3swm_C1e-11111687174NAC domain-containing protein 19
3swm_D1e-11111687174NAC domain-containing protein 19
3swp_A1e-11111687174NAC domain-containing protein 19
3swp_B1e-11111687174NAC domain-containing protein 19
3swp_C1e-11111687174NAC domain-containing protein 19
3swp_D1e-11111687174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.46230.0flower| fruit| leaf| vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464708.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ93VY31e-135NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A067G6D80.0A0A067G6D8_CITSI; Uncharacterized protein
STRINGVIT_19s0014g03290.t011e-175(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-131NAC family protein